PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00000815-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 292aa    MW: 32038.9 Da    PI: 10.0439
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00000815-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.31.5e-1298142347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT++E+  ++ + ++lG+g+W+ I+r   ++Rt+ q+ s+ qky
  WALNUT_00000815-RA  98 PWTEDEHRTFLIGLEKLGKGDWRGISRNYVTTRTPTQVASHAQKY 142
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.532318IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.69391147IPR017930Myb domain
SuperFamilySSF466893.59E-1792147IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-1894146IPR006447Myb domain, plants
SMARTSM007171.2E-895145IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-1095141IPR009057Homeodomain-like
PfamPF002493.2E-1098142IPR001005SANT/Myb domain
CDDcd001674.21E-898143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MGRKCSHCGN IGHNSRTCTT YRGNSSAGLR LFGVQLDLSS SSVAMKKSFS MDCLYSSPSP  60
SSSFSSGISI DENSDKTTIG YLSDGLIGRP QERKKGVPWT EDEHRTFLIG LEKLGKGDWR  120
GISRNYVTTR TPTQVASHAQ KYFLRQASLD KKKRRSSLFD MVGRSNMCGQ PAKSSNSKPS  180
DHPVRTQYNP DQHKLHKDSN LPDLQGLTSS EHVKSENQEI DRLQLASRNQ AVPVWLYGLL  240
DSRLNASNAA KPSSSNAAPN LELTLAAPRP LEQNKSSPEP LVLGPISVQI HG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1150154KKKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00565DAPTransfer from AT5G56840Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002282498.11e-118PREDICTED: uncharacterized protein LOC100247499
TrEMBLD7TB951e-118D7TB95_VITVI; Putative uncharacterized protein
STRINGVIT_11s0016g02410.t011e-118(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32133271
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.17e-55MYB_related family protein